PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 678aa    MW: 73912 Da    PI: 5.9463
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00129genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.7e-14217277363
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 + kr  r+++NRe+A+ sRqRKk ++eeLeekv +++   ++L ++++    e a+l+++v
  AA61G00129 217 DGKRNARLIRNRESAQLSRQRKKHYVEELEEKVRNMQFTITDLNSKISYFMAENATLRQQV 277
                 5699*************************************************99999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-14215279IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76217277IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.06E-12219277No hitNo description
PfamPF001701.4E-12219277IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-16219277No hitNo description
CDDcd147042.45E-20220271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MAEQSVDEPP PVSDPNPSFS PLYNLTSDQA PLENSMSGLD FLVDGDGDFE LSLDGVDELY  60
FPSENESFFI PVDSTNQERS GNFTPGSEGS GISGNDVQED AVRDMNGELC ISGCCNRESP  120
RDSDCCEAQQ SLILSTPMSS QESGNCGSDV LEATNASSPK SGNIVVDQKV KVEEAATASI  180
TKRKKEIEEV TSEESMETKY RRLSEDGAAS AVTCEDDGKR NARLIRNRES AQLSRQRKKH  240
YVEELEEKVR NMQFTITDLN SKISYFMAEN ATLRQQVGAS TGMHPPHHPP RPGMYPSMAP  300
MPYPWMPCPA YMVKQQGSQV PLLPIPRLKP QQPVAKVKKS ESKRSVAKTK KVAGISFLGI  360
LLCLCLFGAL TPLLNVNYGG ISSAFLGEFK SNYVTDRISD QPRERVLNVS ISSSDTGRNI  420
SATDESVAPG NGSEPLVASL FVPRNDKLVK IDGNLIIHSI LASEKAMASR KASETKDEVK  480
NSLAIHKDFS PKYLYRTDSE KQKALSSASA DTQKDQFRSA TMNGEMQQWF REGAAGPMFS  540
SGMCNEVFKF DVSSTSGAII PASPATNVSS TSQTKNTTNT HNGKKNRRIL RDGLPVTNFN  600
LTKDHKRNGS GKETKSTPSM VVSVLADPRE VGERDINGMF VGPESVSRVF VVVLVDGVKY  660
VTYSCVLPRS GVPHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGAT2G40950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein